PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC2455_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WOX
Protein Properties Length: 207aa    MW: 23224.7 Da    PI: 6.3995
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC2455_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.81.2e-2080140257
                 T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                 r+R+t+t++ql++Le+ +e+ + +p++++++e+A++l    ++te++V++WFqNrRa+ k+
  RrC2455_p2  80 RNRWTPTSTQLQILESIYEErSGTPNRRRIREIAAELsehgQITETNVYNWFQNRRARSKR 140
                 89*****************98**************************************97 PP

2Wus_type_Homeobox96.62e-3179142265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +r+RWtPt++Q++iLe++y++   tPn+++i++i+aeL+e+G+i+++NV++WFQNr+aR+++kq
         RrC2455_p2  79 TRNRWTPTSTQLQILESIYEERSGTPNRRRIREIAAELSEHGQITETNVYNWFQNRRARSKRKQ 142
                        689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-1674144IPR009057Homeodomain-like
PROSITE profilePS5007115.04676141IPR001356Homeobox domain
SMARTSM003893.0E-1478145IPR001356Homeobox domain
SuperFamilySSF466895.56E-1878142IPR009057Homeodomain-like
CDDcd000865.57E-1580142No hitNo description
PfamPF000462.4E-1880140IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0051301Biological Processcell division
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MEKESQNGAY VGRGVMTEEQ METLRKQIAV YAVICEQLAL LHNSLSSFHP LSSGMNPNGG  60
GYFDPMVVAS SSAHQRISTR NRWTPTSTQL QILESIYEER SGTPNRRRIR EIAAELSEHG  120
QITETNVYNW FQNRRARSKR KQTPHTTTTD TGPAEDAAVV TTDEKRSCGD SGGFESYEHI  180
LFPSPDLGIE HLLSRGELSG EFNSYRL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133141RRARSKRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892471e-129AC189247.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB018K09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009149550.11e-131PREDICTED: WUSCHEL-related homeobox 14-like
RefseqXP_013587710.11e-131PREDICTED: WUSCHEL-related homeobox 14-like
SwissprotQ9LM841e-110WOX14_ARATH; WUSCHEL-related homeobox 14
TrEMBLM4EAN01e-131M4EAN0_BRARP; Uncharacterized protein
TrEMBLA0A0D3CBV01e-131A0A0D3CBV0_BRAOL; Uncharacterized protein
STRINGBra025839.1-P1e-130(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122111732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20700.11e-108WUSCHEL related homeobox 14